Chickens (Gallus gallus domesticus) and their eggs have been used extensively as research models throughout the history of biology. Today they continue...

The game of chicken, also known as the hawk-dove game or snowdrift game, is a model of conflict for two players in game theory. The principle of the game...

The Center for Biologics Evaluation and Research (CBER) is one of six main centers for the U.S. Food and Drug Administration (FDA), which is a part of...

Thus, it makes for a suitable model for a number of research applications in the field of biological and biomedical research: Vascular development and angiogenesis...

proliferation of global transport networks makes this model of society susceptible to the spreading of biological diseases. Digital networks become volatile under...

their biological father is Evelio Thanatos, a geneticist specialised in stem cell research. To learn about their mother and to meet their biological father...

Sex is the biological trait that determines whether a sexually reproducing organism produces male or female gametes. During sexual reproduction, a male...

living organisms, which he called "biological transmutation". He made this claim after experimenting with chickens, which he believed showed that they...

Biological warfare, also known as germ warfare, is the use of biological toxins or infectious agents such as bacteria, viruses, insects, and fungi with...

phenotypic traits. Recent genetic research distinguishes between three forms of pleiotropy: Biological pleiotropy also known as horizontal pleiotropy is when...

Theoretical Biology – the mathematical modeling of biological phenomena. Systems biology – computational modeling of biological systems. Zoology – study of animals...

A model organism is a non-human species that is extensively studied to understand particular biological phenomena, with the expectation that discoveries...

the chicken eaters' risk = 22/74 = 0.297 And non-chicken eaters' risk = 2/35 = 0.057. Those who ate the chicken had a risk over five times as high as those...

"is a chicken a meteor?") when the relevant nodes are very far apart in the network. TLC is an instance of a more general class of models known as semantic...

The Biological General Repository for Interaction Datasets (BioGRID) is a curated biological database of protein-protein interactions, genetic interactions...

the B-globin gene cluster in Chickens.... He continued in the same department for six more years as Assistant Research Chemist studying gene expression...

Gain-of-function research (GoF research or GoFR) is medical research that genetically alters an organism in a way that may enhance the biological functions of...

Developing Chicken Eggs Migrates from Egg White to Embryonic Organs while Changing Its Conformation and Thermal Stability*". Journal of Biological Chemistry...

locations on the chicken Z chromosome, such as the MHM region, are thought to exhibit regional dosage compensation, though researchers have argued that...

greater prairie chickens, which were prevalent in North America until the 20th century. In Illinois alone, the number of greater prairie chickens plummeted...

erratic electricity supply. They can be used in a farmhouse, such as a large chicken-raising facilities, or they can be found in a common classroom for...

that are unique to birds. Most avian immunology research has been carried out on the domestic chicken, Gallus gallus domesticus. Birds have lymphoid tissues...

chronobiologist known for his research on the biological clocks that regulate seasonal reproduction in vertebrates. He currently serves as the director of the Institute...

his work as a science writer, as well as a philosopher and an activist. His scientific work covered a variety of biological fields such as amphibian...

system that yields construction of an identical or similar copy of itself. Biological cells, given suitable environments, reproduce by cell division. During...

phospholipid identified in 1847 as such in biological tissues was lecithin, or phosphatidylcholine, in the egg yolk of chickens by the French chemist and pharmacist...

length. For example: >MCHU - Calmodulin - Human, rabbit, bovine, rat, and chicken MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTID...

sexual activity involving a female eland with an ostrich, a male dog with a chicken, a male monkey with a snake, and a female chimpanzee with a cat. A 2008...

direct biological study in connection with their significance to human health; this has incidentally included study of some laboratory animals such as chickens...

Irreducible complexity (IC) is the argument that certain biological systems with multiple interacting parts would not function if one of the parts were...