• The C-terminus (also known as the carboxyl-terminus, carboxy-terminus, C-terminal tail, carboxy tail, C-terminal end, or COOH-terminus) is the end of an...
    5 KB (583 words) - 18:03, 18 April 2024
  • the C-terminus, and a free amine group on the other end called the N-terminus. By convention, peptide sequences are written N-terminus to C-terminus, left...
    7 KB (749 words) - 23:10, 30 March 2024
  • which forms the N-terminus, and the carboxyl group, which forms the C-terminus; amino acid sequences are assembled in the N-to-C direction during translation...
    272 KB (24,805 words) - 05:52, 18 May 2024
  • Thumbnail for Protein
    as the N-terminus or amino terminus, whereas the end of the protein with a free carboxyl group is known as the C-terminus or carboxy terminus (the sequence...
    99 KB (11,206 words) - 22:01, 5 June 2024
  • bond to the C-terminus, but entropically it was more favorable to hydrogen bond with the N-terminus. Specifically, they found that C-terminus hydrogen bonding...
    22 KB (3,073 words) - 17:49, 30 December 2023
  • Thumbnail for Integral membrane protein
    positioned such that their carboxyl-terminus is towards the cytosol, or Type II, which have their amino-terminus towards the cytosol. Type III proteins...
    9 KB (1,035 words) - 19:59, 25 January 2024
  • Thumbnail for Ubiquitin
    covalently bound through its C-terminal carboxylate group to a particular lysine, cysteine, serine, threonine or N-terminus of the target protein. Polyubiquitylation...
    98 KB (11,068 words) - 02:47, 20 February 2024
  • Thumbnail for G protein-coupled receptor
    extracellular N-terminus, cytoplasmic C-terminus, whereas ADIPORs are inverted). In terms of structure, GPCRs are characterized by an extracellular N-terminus, followed...
    82 KB (9,384 words) - 23:27, 16 May 2024
  • (usually 16-30 amino acids long) present at the N-terminus (or occasionally nonclassically at the C-terminus or internally) of most newly synthesized proteins...
    15 KB (1,741 words) - 18:05, 31 December 2023
  • Thumbnail for Cytochrome c
    found towards the C-terminus. The protein backbone is folded into five α-helices that are numbered α1-α5 from N-terminus to C-terminus. Helices α3, α4 and...
    32 KB (3,790 words) - 12:18, 21 May 2024
  • Thumbnail for His-tag
    consists of at least six histidine (His) residues, often at the N- or C-terminus of the protein. It is also known as a hexa histidine-tag, 6xHis-tag, or...
    22 KB (2,639 words) - 16:13, 23 January 2024
  • Western blotting. The peptide sequence of the FLAG-tag from the N-terminus to the C-terminus is: DYKDDDDK (1012 Da). Additionally, FLAG-tags may be used in...
    7 KB (846 words) - 23:15, 23 May 2024
  • glycophosphatidylinositol (GPI) is a phosphoglyceride that can be attached to the C-terminus of a protein during posttranslational modification. The resulting GPI-anchored...
    5 KB (642 words) - 19:59, 27 October 2023
  • Thumbnail for Protein primary structure
    in the opposite order (starting at the C-terminus) to biological protein synthesis (starting at the N-terminus). Protein sequence is typically notated...
    21 KB (2,595 words) - 15:26, 27 May 2024
  • Thumbnail for Parvoviridae
    helicase domain toward the C-terminus. Most parvoviruses contain a transcriptional activation domain near the C-terminus that upregulates transcription...
    32 KB (4,019 words) - 20:08, 1 February 2024
  • Thumbnail for Hepatitis C virus
    domain 2 (residues 118–174) is less basic and more hydrophobic and its C-terminus is at the end of p21; domain 3 (residues 175–191) is highly hydrophobic...
    54 KB (6,585 words) - 09:53, 7 March 2024
  • used to modify biopolymers, fragment proteins and peptides (cuts the C-terminus of methionine), and synthesize other compounds. The compound is classified...
    15 KB (1,523 words) - 22:12, 4 June 2024
  • Thumbnail for Single-chain variable fragment
    threonine for solubility, and can either connect the N-terminus of the VH with the C-terminus of the VL, or vice versa. This protein retains the specificity...
    11 KB (1,228 words) - 17:51, 29 July 2023
  • Thumbnail for DNA polymerase
    C-terminus "polymerase relic" region, despite being unnecessary for polymerase activity, is thought to be essential to cell vitality. The C-terminus region...
    59 KB (7,053 words) - 16:38, 28 April 2024
  • Thumbnail for Ribonucleotide reductase
    histidines (H180 and H277). Association occurs between the C-terminus of RNR2 and the C-terminus of RNR1. Enzymatic activity is dependent on association...
    34 KB (3,493 words) - 22:18, 19 May 2024
  • Thumbnail for Chhatrapati Shivaji Terminus
    Chhatrapati Shivaji Terminus (officially Chhatrapati Shivaji Maharaj Terminus since 2017, formerly Victoria Terminus (VT), Bombay station code: CSMT (mainline)/ST...
    24 KB (2,162 words) - 18:47, 26 May 2024
  • Thumbnail for Phage display
    linker between the cDNA and pIII at the C-terminus. pVIII is the main coat protein of Ff phages. Peptides are usually fused to the N-terminus of pVIII. Usually...
    38 KB (4,622 words) - 00:46, 4 April 2024
  • Thumbnail for Directionality (molecular biology)
    5′-to-3′ direction, and will extend the protein from its N-terminus toward its C-terminus. For example, in a typical gene a start codon (5′-ATG-3′) is...
    9 KB (1,191 words) - 13:38, 29 May 2024
  • Thumbnail for Amylin
    of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^...
    33 KB (4,044 words) - 04:41, 6 May 2024
  • Thumbnail for Beta sheet
    Because peptide chains have a directionality conferred by their N-terminus and C-terminus, β-strands too can be said to be directional. They are usually...
    26 KB (3,100 words) - 18:37, 22 December 2023
  • Thumbnail for Wiskott–Aldrich syndrome protein
    autoinhibited conformation with sequences near its C-terminus binding to a region near its N-terminus. Its activation is dependent upon CDC42 and PIP2 acting...
    21 KB (2,588 words) - 00:21, 5 February 2024
  • atomic mass and has 10 amino acids. It can be fused to the C-terminus and the N-terminus of a protein. It is advisable not to fuse the myc-tag directly...
    2 KB (296 words) - 22:15, 4 April 2024
  • often depends on certain sequences of amino acids located at the N terminus or C terminus. These sequences are known as signal peptides, molecular signatures...
    2 KB (197 words) - 17:38, 12 August 2023
  • trafficking cycle are believed to be encoded in the C-terminus. A dileucine motif in the C-terminus is required for VMAT2 endocytosis. Studies suggest...
    43 KB (4,993 words) - 22:10, 12 March 2024
  • Thumbnail for Chemokine
    Chemokine (redirect from C-C motif)
    intracellular and three extracellular hydrophilic loops, and an intracellular C-terminus containing serine and threonine residues important for receptor regulation...
    30 KB (2,916 words) - 11:52, 3 December 2023