Glucagon is a peptide hormone, produced by alpha cells of the pancreas. It raises the concentration of glucose and fatty acids in the bloodstream and is...

Glucagon-like peptide-1 (GLP-1) is a 30- or 31-amino-acid-long peptide hormone deriving from the tissue-specific posttranslational processing of the proglucagon...

The glucagon receptor is a 62 kDa protein that is activated by glucagon and is a member of the class B G-protein coupled family of receptors, coupled...

Glucagon, sold under the brand name Baqsimi among others, is a medication and hormone. As a medication it is used to treat low blood sugar, beta blocker...

Glucagon-like peptide-1 (GLP-1) receptor agonists, also known as GLP-1 analogs, GLP-1DAs or incretin mimetics, are a class of drugs that reduce blood sugar...

Glucagon receptor agonists are a class of drugs under development for the treatment of obesity, non-alcoholic fatty liver disease, and congenital hyperinsulinism...

Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans...

of Langerhans in the pancreas. Alpha cells secrete the peptide hormone glucagon in order to increase glucose levels in the blood stream. Islets of Langerhans...

after meals. Glucagon is another hormone involved in regulating blood glucose levels, and can be thought of as the opposite of insulin. Glucagon helps to...

for long-term weight management. It is a peptide similar to the hormone glucagon-like peptide-1 (GLP-1), modified with a side chain. It can be administered...

mostly to regulate blood sugar levels, secreting the hormones insulin, glucagon, somatostatin and pancreatic polypeptide. As a part of the digestive system...

The glucagon-like peptide-1 receptor (GLP1R) is a G protein-coupled receptor (GPCR) found on beta cells of the pancreas and on neurons of the brain. It...

The glucagon receptor family is a group of closely related G-protein coupled receptors which include: Glucagon receptor Glucagon-like peptide 1 receptor...

Glucagon rescue is the emergency injection of glucagon in case of severe diabetic hypoglycemia. It is needed during seizures and/or unconsciousness by...

Glucagon/gastric inhibitory polypeptide/secretin/vasoactive intestinal peptide hormones are a family of evolutionarily related peptide hormones that regulate...

sugar to normal levels. Glucagon, another hormone produced by alpha cells, is secreted in response to low blood sugar levels; glucagon stimulates glycogen...

– was approved by the FDA in 2006. Glucagon increases blood glucose levels, and DPP-4 inhibitors reduce glucagon and blood glucose levels. The mechanism...

stimulate glucagon upon hypoglycemia prevents a glucagon-mediated rescue of glucose levels. Onset of type 1 diabetes is followed by an increase in glucagon secretion...

Oxyntomodulin (OXY or OXM, 53–89) Glucagon (53–81) Glucagon-like peptide 1 (GLP-1, 92–128) – first seven residues further cleaved Glucagon-like peptide 2 (GLP-2,...

blood-glucose–dependent mechanism. Some incretins (GLP-1) also inhibit glucagon release from the alpha cells of the islets of Langerhans. In addition,...

being an incretin, is to stimulate insulin secretion. GIP, along with glucagon-like peptide-1 (GLP-1), belongs to a class of molecules referred to as...

nausea, diarrhea, vomiting, abdominal pain, and decreased appetite. It is a glucagon-like peptide-1 receptor agonist (GLP-1 agonist) consisting of GLP-1(7-37)...

around glucagon-like peptide-1, a hormone that stimulates the production of insulin but has a short half-life of minutes in the body. Glucagon-like peptide-1...

peptide that works as a dual glucagon/GLP-1 receptor agonist. Unlike other dual GLP-1/glucagon dual agonists, it is an glucagon analog rather than an analog...

University. Her research considers peptide synthesis. She discovered the glucagon-like peptide-1 and uncovered its role in glucose metabolism and the secretion...

referred to as glucose homeostasis. Insulin, which lowers blood sugar, and glucagon, which raises it, are the most well known of the hormones involved, but...

Sutherland conducted research on the effects of the hormones epinephrine and glucagon on the breakdown of glycogen to glucose. In 1942, he worked as an intern...

of drugs that activate multiple peptide hormone receptors including the glucagon-like peptide-1 (GLP-1) receptor. These drugs are developed for the same...

hormone-sensitive lipase. It was previously thought that upon release of glucagon from the pancreas, glucagon receptors cause a phosphorylation cascade that activates...

Use in pregnancy and breastfeeding is of unclear safety. Exenatide is a glucagon-like peptide-1 receptor agonist (GLP-1 receptor agonist) also known as...