Glucagon-like peptide-1 (GLP-1) is a 30- or 31-amino-acid-long peptide hormone deriving from the tissue-specific posttranslational processing of the proglucagon...

The glucagon-like peptide-1 receptor (GLP1R) is a G protein-coupled receptor (GPCR) found on beta cells of the pancreas and on neurons of the brain. It...

Glucagon-like peptide-1 (GLP-1) receptor agonists, also known as GLP-1 analogs, GLP-1DAs or incretin mimetics, are a class of drugs that reduce blood sugar...

The glucagon receptor is a 62 kDa protein that is activated by glucagon and is a member of the class B G-protein coupled family of receptors, coupled to...

under the brand name Wegovy for weight loss. Semaglutide is a glucagon-like peptide-1 receptor agonist. The most common side effects include nausea, vomiting...

Glucagon-like peptide-2 receptor (GLP-2R) is a protein that in human is encoded by the GLP2R gene located on chromosome 17. The GLP2 receptor (GLP2R)...

glucagon-like peptide receptors (GLPRs) include the following two receptors: Glucagon-like peptide 1 receptor (GLP-1R) – binds glucagon-like peptide 1...

Glucagon is a peptide hormone, produced by alpha cells of the pancreas. It raises the concentration of glucose and fatty acids in the bloodstream and...

breastfeeding is of unclear safety. Exenatide is a glucagon-like peptide-1 receptor agonist (GLP-1 receptor agonist) also known as incretin mimetics. It works...

glucagon receptor family is a group of closely related G-protein coupled receptors which include: Glucagon receptor Glucagon-like peptide 1 receptor Glucagon-like...

is a glucagon-like peptide-1 receptor agonist (GLP-1 agonist) consisting of GLP-1(7-37) covalently linked to an Fc fragment of human IgG4. GLP-1 is a...

candidate peptides that fulfill criteria for an incretin are the intestinal peptides glucagon-like peptide-1 (GLP-1) and gastric inhibitory peptide (GIP,...

liraglutide, which is an agonist for the glucagon-like peptide-1 receptor. It is a chemical analogue of glucagon-like peptide-1 with a fatty acid and spacer attached...

Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans...

outcomes like heart disease and life expectancy are unclear. It is given by injection under the skin. Liraglutide is a glucagon-like peptide-1 receptor agonist...

non-peptide glucagon-like peptide-1 receptor agonist developed as a weight loss drug by Eli Lilly and Company. It is easier to produce than GLP-1 agonists...

2006). "Design of a long acting peptide functioning as both a glucagon-like peptide-1 receptor agonist and a glucagon receptor antagonist". The Journal of...

natriuretic peptide (ANP) Calcitonin Cholecystokinin (CCK) Gastrin Ghrelin Glucagon Glucose-dependent insulinotropic polypeptide (GIP) Glucagon-like peptide-1 (GLP-1)...

Drucker, D. J.; Nauck, M. A. (2006). "The incretin system: Glucagon-like peptide-1 receptor agonists and dipeptidyl peptidase-4 inhibitors in type 2 diabetes"...

constipation, upper abdominal discomfort, and abdominal pain. Glucagon-like peptide-1 (GLP-1) and glucose-dependent insulinotropic polypeptide (GIP) are...

incretin, is to stimulate insulin secretion. GIP, along with glucagon-like peptide-1 (GLP-1), belongs to a class of molecules referred to as incretins,...

Formyl peptide receptor 1 (FPR1, FPR1 receptor, fMet-Leu-Phe receptor 1, FMLP receptor 1, or N-formylmethionyl-leucyl-phenylalanine receptor 1) is a cell...

(June 2022). "A Small-Molecule Oral Agonist of the Human Glucagon-like Peptide-1 Receptor". Journal of Medicinal Chemistry. 65 (12): 8208–8226. doi:10...

inhibitory peptide, an incretin, which also promotes triglyceride storage. K cells are mostly found in the duodenum. L cells secrete glucagon-like peptide-1, an...

melanocortin 1 receptor (MC1R), also known as melanocyte-stimulating hormone receptor (MSHR), melanin-activating peptide receptor, or melanotropin receptor, is...

weight exerted by glucagon-like peptide-1 (GLP-1) receptor stimulation. Outside the CNS, it seems that IL-6 stimulates the production of GLP-1 in the endocrine...

High School Glucagon-like peptide-1 (GLP-1) Glucagon-like peptide-1 receptor agonists are sometimes referred to as "GLPs" Glucagon-like peptide-2 (GLP-2)...

2 diabetes: glucagon-like peptide-1 receptor agonists and dipeptidyl peptidase-4 inhibitors". Diabetes, Obesity & Metabolism. 9 (Suppl 1): 23–31. doi:10...

Mathies M.; Christensen, Mikkel B. (3 July 2021). "Emerging glucagon-like peptide 1 receptor agonists for the treatment of obesity". Expert Opinion on Emerging...

include glucagon-like peptide-1 receptor agonists (GLP-1 agonists), GLP-1 and glucose-dependent insulinotropic polypeptide (GIP) or glucagon co-agonists...